 |
 |
|
|
| |
| |
| |
|
|
|
| Out in 10 |
| A hodgepodge of different articles on various locales/artists/foods/issues... things (for lack of a better word), and numerous means for saving money (which as a college student is a pretty big deal). |
| Language: English |
| RSS Feeds for this Blog |
|
Statistics |
| Unique Visitors: 34 |
| Total Unique Visitors: 64368 |
| Visitors Out: 782 |
| Total Visitors Out: 782 |
|
|
|
| |
|
|
| |
|
| PCN Awaken Movement! |
| 2008-03-14 22:02:00 |
Sorry I've been away for so long. Been working on this and that, including working on promoting this year's PCN. Fun stuff! Anyway, here is the trailer for this year, showing the beginning of a movement for this year's show themed "Awaken Movement." Turn up the volume and the bass and feel the music while you're at it :P
...
|
| |
|
| How Vast is Our Universe? VAST |
| 2008-03-05 00:11:00 |
I haven't heard any recent developments on String Theory, which I find myself fascinated by. Nonetheless, the universe is still a beautiful and vast things, portrayed very nicely by Nikon.I like the descriptions and information this page give you as well. Very zen-like.
...
|
| |
|
| Our World as Food |
| 2008-02-15 12:24:00 |
I've seen a lot of images recently with food being made into I really like the cyclist and candy tin ones :)
...
|
| |
|
| Make Money Fast, Even While Just Chilling |
| 2008-02-08 17:36:00 |
Recently checked out this new pay to click site called Bux.to and was struck by the fact that you could make money quickly for simply viewing pages. With the technology out there, this process can be automated so that simply by leaving your computer on, you can accumulate money over X amount of time, so long as you're connected to the internet.Here is what you need to do to for this process to work:1. First of all you need Firefox, so download and install it, or open it up.2. Secondly, you need to have an alertpay account. This is similar to paypal.3. Sign up for Bux.to.Please leave name my name (ksquad) as your referral in your registration. By doing this I'll receive credits from Bux.to and be very grateful.4. How Bux.to works.The way Bux.to works is t...
|
| |
|
| An Additional $3.94, Yippee! |
| 2008-02-08 16:02:00 |
For those of you that hadn't seen my previous post about how I made $1.16 risk-free, click here. Anyway, for the month of January, thus far, I've made $5.10 by pretty much just making educated guesses.Here is a screenshot of my earnings.Hmmm, enough to get a meal... what kind of food do I feel like?Hahaha, I do recommend you check out my article on Predictify and here to register for a pretty cool social network. Like all of the other links on the outset of the page, this is risk free and can only help you learn and earn :)EDIT: I made an extra $4.35 after submitting this post for the month of January from Predictify, $1.76 from Kickitback for purchasing things on eBay, and $1.23 from the risk-free stock market site The UpDown; a total of $12.74. :)
...
|
| |
|
| The Next Generation of Designing Technology |
| 2008-02-08 02:10:00 |
OMG, this is so much better than the tablet I have. Haha, technology and the things we can do with it never ceases to amaze me. Simply check this out, a PC that uses e-ink and RF technology to allows designers to draw in color (allowing them to skip the very tedious stage of transferring the sketch into a digital format).Here are a couple of images to possibly drool over :P
...
|
| |
|
| Select the Text Below |
| 2008-02-03 23:45:00 |
Like the people who like to name small things, comes two sites from people that have too much time on their hands.This first site has some 470 issues that kids face in their lives. So many problems, and yet we think we have it though.Secondly, is this site about text highlighting.What is interesting about this site is that it says it's just about having fun with highlighting and yet there seems to be something more subversive, even perhaps counterculture-esque about it. Do you do what the site tells you? Or engage this whim by counteracting. Maybe this is just me over exaggerating what I see, or the fact that I haven't read all of the text.Seems like a familiar trend... ughh, back to the books now.
...
|
| |
|
| WiFi to hit BART? |
| 2008-02-03 03:15:00 |
I thought this article was pretty interesting. Makes me wonder why though, since the shortness of most trips and potential disruptions make such a service questionable.Merely hours after hearing that a contactless payment trial was going live on San Francisco's BART, along comes word that a test of a slightly different nature was also underway on the very same public transportation system. Reportedly, a recent Wi-Fi Rail installation on a select stretch of track proved that WiFi could be delivered to passengers at around 15Mbps -- up and down -- and if things go smoothly, the firm hopes to get its technology onto all sorts of rail systems across the globe. Unfortunately, there doesn't look to be any firm plans for the trial to stick on BART, but who knows, keep on refreshing that nearby network list on the morning commute and you might just get lucky.
...
|
| |
|
| Let the Pig do Your Snooping |
| 2008-01-29 17:21:00 |
Ever wonder if that job application you sent was read? Does your mother, brother, sister, lover, friend read the emails you send?Introducing, SpyPig.SpyPig takes all the guesswork out of emails. The newly launched site with a catchy name uses the same sort of technology spammers use to see if your email is real and actively read. How? you ask. Spammers embed images in their emails. Once you open your email, the image loads and, a unique identifier is sent back to the spammer letting them know that yours is a valid email address. With SpyPig, you enter your email address, message title and then choose from a small selection of SpyPig images to embed. They range from a cute little pig, to a little text graphic reading "I know you’ve read my email!â€. Or if you want to go incognit...
|
| |
|
| Save on Texbooks |
| 2008-01-28 23:55:00 |
Although I'm all for supporting the school for various things, I can't help get my head around the price of textbooks. When I had to buy a fairly thin one for one of my classes, I was surprised to have to put down almost a hundred. To this end, and having learned how much I could save by doing some work, I must say that I:1. Support buying books from other students.I like to do this through the site comegetused which is owned and operated by a Berkeley alumnus and an UCLA student (and dedicated to promoting the exchange of textbooks among fellow students). My profile and books, should you want them are located here.2. Use one of two sites, as they allow you to see a wide range of offerings and sometimes coupons that can be applied, ecampus and alibris.3. A combination of buying books fr...
|
| |
|
| Can't Help But Feel All Warm and Fuzzy |
| 2008-01-26 23:40:00 |
I think there's something really exciting about the New Year. Can't just help but feel all warm and fuzzy on the inside. Here are some videos of displays from around the world :)SydneyLondonMoscowHong KongTaipeiParisAucklandNew YorkOrlando Disney LandOf course the best would be saved for last ;)
...
|
| |
|
| Spin Like Tiesto On a Budget |
| 2008-01-25 13:29:00 |
My favorite dance song right now, has still got to be, "In The Dark" by Tiesto. The beat, the sounds, the base... oooooh. Almost makes me want to go back to those days when I wanted to be a VJ (Video Jockey), almost.Introducing, the Pacemaker - the world’s first professional pocket-sized DJ system.Created by Tonium Laboratories, it features 120 GB of music storage that can be plugged in to the nearest sound system, so that you always have the ripest jams to get the room moving. It also features a table-top to mix and match your favorite songs.Pacemaker's software automatically works out the BPMs (beats per minute) of each track, enabling you to quickly learn to match the beats between two tracks and create a DJ mix. Pacemaker works with both PC and MAC and supports all the major audio formats including MP3, WAV, AAC, OGG and FLAC files. It also features two output channels and equalizer for even more fun!
...
|
| |
|
| Got Some Time to Kill? |
| 2008-01-24 12:49:00 |
Check out this image called "The Map of Humanity."See if you can find your closest major city. What do you think about its placement? Also, see if you can find Disneyland. I remember seeing it once, but now I can't seem to find it :P
...
|
| |
|
| Days Really Can Fade Away |
| 2008-01-23 23:43:00 |
I remember visiting my friend at the Getty Museum, while he was working there over the summer, and getting a badge for the day that allowed me to see his workspace. Anyway, it was really cool, in that, by the end of the day, the badge had slowly changed color to reveal that my badge should be voided. What a fancy way of increasing security, eh?I think heat reactive technology is really cool. Just below, is a calendar that uses a similar process except backwards.And here are more images of reactive wallpaper:
...
|
| |
|
|
| Onliwhol Buildiaripest blakesymmehairibiggerlik... Say what?! |
| 2008-01-22 14:43:00 |
Some people say that I have too much time on my hands. I would have to agree, but it is still break after all. I would have to say that these people have far more time on their hands.Who has the time to draw up a new method of nomenclature, to find all of these small items, or to process them, for that matter?I'm not saying anything negative about this group at all; after all to have this much imagination and fun doing something, I must give props.However, it is slightly weird us outsiders.Onliwhol Buildiaripest blakesymmehairibiggerlik (otherwise known as a fly)Nelipart Machapplimecho metalicircuhardunlik (otherwise known as a cog)Nelipart Houseconjoin metalicylishinibiggerlik (a screw?)Onlipart Porchedeco multicoirresoftotherlik (a flower?)
...
|
| |
|
| C?YK |
| 2008-01-21 14:01:00 |
As someone who has worked with print for quite some time, this is somewhat humorous:As it turns out, the mother company behind T-Mobile, Deutsche Telekom AG, has put in a legal claim to register the color Magenta with the European Brandoffice. Not sure exactly what this means but it is slightly frightening to see that something like this...Where companies own colors like they do stadiums, broadcasts, parks, etc., can actually happen.Following are just a couple of humorous and inquisitive protest images created by the concerned.For more, click here.
...
|
| |
|
| Furniture That'll Give You Real Peace of Mind |
| 2008-01-20 19:25:00 |
I'm all into items that serve multiple uses (think about my desk and bed which are both very sturdy but can fold to save space), but this is crazy.It's laughable, but practical at the same time.Think about all those times when you heard someone other than a family member or a roomie and you had to go and check with nothing more than maybe a pen in your hand. You know you want one. Hahaha, check it out here at James McAdams
...
|
| |
|
| That's What She Twittered |
| 2008-01-19 13:25:00 |
Are you simply infatuated with updating your status every other minute? Or perhaps, looking for a new way to market a new idea/product/space?Introducing, Twitter - What are you doing?As the site reveals, Twitter is "a service for friends, family, and co–workers to communicate and stay connected through the exchange of quick, frequent answers to one simple question: What are you doing?"It comes out of the idea that "basic updates are meaningful to family members, friends, or colleagues—especially when they’re timely."(I think these ideas are funny) * Eating soup? Research shows that moms want to know. * Running late to a meeting? Your co–workers might find that useful. * Partying? Your friends may want to join you.Twitter allows you to control how much...
|
| |
|
| Safeguarding Your Identity Online |
| 2008-01-18 13:52:00 |
It's pretty crazy thinking about all the things that have developed as a result of Google's influence. Perhaps one of the least looked upon side of this influence is its ability to be a reputation wrecker.With one story gone horribly wrong, searching your name, you might find things friends, family, and even future employees might cringe at. To this end, here is a list that I found of ten things that can be done to get that negative result off of the first search page.1. Get your own web site2. Start a blog3. Add a sub-domain4. Create a social networking profile5. Create your own social network6. Create a business profile7. Share your photos8. Claim your identity9. Create your own Wiki10. Get a free page from GoogleAdditionally, this site, Ziki.com, is pretty helpful in finding out what content is available on the web with your name on it. Just type in your name and/or variations of your name and it will draw up results with your name on it.For more information on this list, click here.
...
|
| |
|
| Laws of Branding and Logo Design |
| 2008-01-17 12:54:00 |
I saw this information and immediately fell in love...Why are these among the best, most recognizable logos in the world? Put simply: They can be burned on to the butt of a cow.While "branding" has come to mean a large-scale marketing philosophy, let's not forget where the word "brand" comes from. One of the things that makes these logos so powerful is that they are simple without being simplistic; even tiny and without color, they are easy to identify.In the larger sense, branding is an attempt to garner an emotional response to one's products and/or services. This may include specific color schemes, design styles, advertising focus, research and development, even hiring practices...
|
| |
|
| Say NO To Retail Prices |
| 2008-01-16 02:00:00 |
Here's another way to save money, coupons! I know when I heard one of my friends talking about how he had spent most of the day cutting up coupons I thought he was crazy, but if you really think about it, it's not at all. Perhaps the time involved may be crazy, but even if you're doing shopping online, it doesn't at all hurt to spend a couple minutes looking for a coupon that may, at the very least, be worth a couple dollars in savings.There are many sites out there, but one that I like is called Retailmenot.com. It is a spin off of it's successful sister site, Bugmenot.com - login with these free web passwords to bypass compulsory registration. Retailmenot.com has numerous coupon codes for those sites that you might typically shop at online, supported by users like you.In any case, if you're looking to save a couple bucks, try these sites. It couldn't hurt, anyway, to learn something new.
...
|
| |
|
| Ever Wanted A Spam Phone Number? |
| 2008-01-15 11:57:00 |
I know it's kinda of sketchy but have you ever wanted to get someone else's number yet didn't want them to have your real number in the exchange? Or have you wanted to sign up for any number of things only to feel unsure about giving out your real phone number?Introducing, two services:Numbr.comNumbr offer free disposable, real phone numbers.You can get numbers in any area code that you want. You then select when you want the number to expire – an hour, a day, a week or a month. The disposable number is discreetly forwarded to your real number, so you can get a verification call if needed by the company. After said time the phone number becomes invalid so you never have to worry about any more calls.BrringIf you need a number that is going to last for longer than a month and you want to make money off of your callers then Brring might be for you.You get paid every time someone calls your Brring number. The caller calls your Brring number and listens to a short (5 second) advertisement. They are then forwarded right to your normal number without ever knowing what your normal number is.They have ads about travel, cars, electronics, fashion, politics, etc. Although I haven't used this service, I was just thinking that one could use this number for those free offers you might see at expo's, fairs, etc. that involve a phone number (since they will not know your real number and you'll be getting money from it).
...
|
| |
|
| A Toy Where the Box is the Toy |
| 2008-01-15 03:46:00 |
I don't normally like toys, but this is pretty awesome:It makes me want to step up from the mascot costume I made for last Halloween to make something even better, a box robot costume.So simple and yet so complicated. Hahah, more images can be found here.
...
|
| |
|
| Vegetables=Musical Instruments |
| 2008-01-14 16:00:00 |
Playing Apples to Apples yesterday, it was interesting to see how many Japanese references there were. Not sure if it was wholly a good thing or not. I mean with things coming out of Japan like Human Tetris and Anime, I'm never really sure the things Japanese culture becomes tokenized as is beneficial or hurtful to an otherwise very rich and diverse culture. Anyway, similarly related to the at times bizarreness that comes out of Japan is this dude.He creates instruments out of vegetables. Slightly amusing, though I would be more impressed if he were to play some songs from any Zelda game with that Ocarina of his.
...
|
| |
|
| The Way Ink Flows |
| 2008-01-13 13:56:00 |
Similarly related to the colorful artistry of Chuck Anderson, is Daniel Eatock and (in particular) his Pantone Pen Prints.He set pens in a frame and stood them, on their nibs, on a large stack of paper.Here are the specs from his site:Pantone Pen PrintDimensions: SRA1 640 x 900mmEdition Size: 73 original prints– One complete set of Letraset TRIA Pantone markers– arranged in the colour spectrum– left for one month– resting on their nibs– on a stack of 500 SRA1 sheets– 70gsm uncoated white paperThe edition number was determined by the number of sheets the ink bled through from 1 through the possible 500.The numbering of each sheet corresponds to the position it was within the stack and also determined its value.The final sheet the ink reached, (furthest from the top) was numbered 1 / 73 and valued at £1, the one above numbered 2 / 73 and valued at £2 etc. The top sheet (the sheet the pens rested on) was numbered 73 / 73 and valued at £73I find this simply amazing. I think I'm even more amazed by a statement that came with his work:Eatock's predictive construct removes the artist's hand from the pen, reverses the role of the paper, and allows its characteristics and positioning to become the most influential aspect of the work. Balanced on their nibs each of a set of 288 felt tip pens releases ink that expands into the layers of a ream of paper, making each layer of this multi-print different. This predicted variety is translated into a gambling tension for the consumer that chooses to purchase an unknown result on an unseen layer.Makes you wonder, huh. "Why didn't I think of that?"
...
|
| |
|
| An Impression of Chuck Anderson's Work in 10 Words |
| 2008-01-13 13:52:00 |
-Ethereal-Colorful-Contemporary-Bold-Sparkly-Magical-Optimistic-Multilayered-Powerful-UrbanHere is Chuck Anderson's Site. I really like "Godlike" and "Humanlike."Must be the color :P
...
|
| |
|
| Got a Eye For Freshness? |
| 2008-01-13 00:14:00 |
Not sure why I notice things like this, but for better or worse have you ever noticed how hot dogs wieners and hot dog buns don't come in equivalent pack numbers (for instance, 8 wieners and 10 buns)? What about the ties on bread colors?Apparently, bread is delivered fresh to the stores five days a week (Monday, Tuesday, Thursday, Friday and Saturday). Each day, consequently, has a different color twist tie. They are:Monday - BlueTuesday - GreenThursday - RedFriday - WhiteSaturday - YellowThe colors go alphabetically by color Blue - Green - Red - White Yellow, Monday thru Saturday, which is fairly easy to remember. Not sure if this is an industry standard but it is mostly applicable. It'll help you tell, for instance, if it's Tuesday, that you shouldn't buy that week old red tie bread.
...
|
| |
|
|
| Photoshop=Money |
| 2008-01-11 01:50:00 |
Ever wanted to turn a hobby into, at the very least, income on the side? The answer to your dream isn't that far off with the explosion of the web.First of all, although most all websites have a webmaster, do they have a graphic designer? Not likely, unless the webmaster also has this skill. There are, as a result, many places where webmasters will look for freelancers to do logo/banner design work.http://www.getafreelancer.comhttp://www.freelancedesigners.comhttp://www.marketingtools.comIf you're more creatively inclined, there are any number of contests out there.Digital PointPhotoshop ContestWorth 1000SitePointIf you're into something a bit more tame, but still necessary, there are lots of jobs for photo retouching.Picwash - Has a young consumer baseGlenn Feron - A little bit more professionalIf you're into designing something for use by a lot of people, design high quality photoshop brushes. There are apparently people that will pay for really nice, high definition brushes. Plus, they're not too hard to make.Lastly, there is some demand for ebook and report cover designers as most of these sellers are of a business mindset.
...
|
| |
|
| Ever Wondered What The Longest Word Was? |
| 2008-01-10 13:30:00 |
Hands down it has got to be the name for the Thai capital, Bangkok (heck I don't even know if I spelled it right).KrungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasitI love my Thai friends, but I'm glad I don't have a friend with a last name this long :P
...
|
| |
|
| Ever Wanted The Recipe Book to Come to You? |
| 2008-01-10 13:09:00 |
This site is pretty cool. It gives you a daily recipe to try out.Here is the recipe for today, Fresh Apricot Thai Salad.Prep: 10 min. * 2 cups sliced fresh apricots * 2 cups diced cooked chicken * 1 cup sliced cucumber, peeled and seeded if necessary * 1 cup bean sprouts, rinsed * 1/4 cup rice vinegar * 1 Tbs. chopped fresh cilantro * 2 tsp. sugar * 1/4 cup vegetable oil * 1/2 tsp. chili oil * 1 package leafy salad greens * 2 Tbs. coarsely chopped peanuts * 1 lime, cut into wedgesIn a large bowl, combine apricots and next 3 ingredients; set aside. In a small bowl, combine vinegar, cilantro, and sugar; whisk in oils. Toss salad with vinaigrette and arrange on plates that have been lined with salad greens. Sprinkle with peanuts and garnish with line wedges.Courtesy: California Fresh Apricot CouncilPer serving: calories 396, fat 27.8g, 61% calories from fat, cholesterol 65mg, protein 21.4g, carbohydrates 18.3g, fiber 4.0g, sugar 11.8g, sodium 65mg, diet points 9.9.Dietary Exchanges: Milk: 0.0, Vegetable: 0.7, Fruit: 0.7, Bread: 0.0, Lean meat: 2.5, Fat: 3.5, Sugar: 0.1, Very lean meat protein: 0.0The only problem with this is that you need to have the items available to create this delicious goodness.For a student who may only have the bare minimum at any given time, this site is very helpful. All you do is put in the quantity of various items you have in the fridge or that you want to cook with. It'll give you a recipe based on the food you have.Cooking made easier.PS: Happy D(ivorce)-Day by the way!
...
|
| |
|
| What Do You Mean You're Not Going to Use the That Extra $6.53? |
| 2008-01-10 00:57:00 |
With the new year, of course, came new laws. One of the more significant ones was one which furthers California's consumer identity--You're now able to get a redemption on gift cards that are $10 or less.As the San Jose Mercury writes:On Jan. 1, consumers will be able to redeem gift cards for cash if the balance is less than $10, thanks to a new law sponsored by state Sen. Ellen Corbett, D-San Leandro.Currently, gift cards worth less than five dollars can be subjected to dormancy fees and a store can refuse to give the remaining value back in cash no matter how small the value.Richard Holober, Executive Director of the Consumer Federation of California, which is based in San Mateo, said, 'Consumers should be aware that any dormant gift cards they have worth less than $10 can be redeemed f...
|
| |
|
| A Paper Bird |
| 2008-01-09 16:33:00 |
Make your own Paper Bird!My only question, why no bird saying ano or 什么?Paperbirds
...
|
| |
|
| Bay Area Rapid Transit? |
| 2008-01-09 01:13:00 |
In hearing that BART raised its prices, I intended to check to see what was going on, but instead got sidetracked by this:Hahaha, get it? Bay Area Rapid Transit...Kk, so anyway, BART did raise it's fees slightly at least for the most part. At the same time, it also increased train frequency, lengthened lines that stopped at Daly City, and made some time changes.Following is the complete low down, so that you don't get shortchanged next time you need to use the real BART:New year brings more trains more often; 33% increase in service, faster commutes, better SFO/Millbrae service and modest fare adjustment.The new year has brought new and improved BART schedule with more trains, more often - especially at night, on weekends and along the San Francisco International Airport (SFO)/Millbrae e...
|
| |
|
| Beginning of an Adventure |
| 2008-01-08 02:56:00 |
Here is Imagineering Loo's first post. It's really touching, hopefully it will make you smile too :)Don't miss out on more exciting entries by the way! Click here to subscribe to a savory feed.
...
|
| |
|
| Skype is Pretty Nifty |
| 2008-01-08 01:02:00 |
Although there are a lot of people already on this service, I haven't gotten into Skype until recently with the purchase of a webcam (which is a cool little thing that provides "the best possible images no matter what kind of light," hence makes me happy).Anyway, Skype is pretty nifty in that you're not only able to talk to anyone with an account for free but contact businesses and other locales with phone numbers, as you might normally, though from the convenience of your computer with the help of your computer/webcam's microphone.It's also just like AIM in that you're able to talk with others online, except there's no typing involved (a plus for those wanting to multi-task) and you do not always have to have your video on (a plus for those who might not look their best at the time).I think it's pretty cool overall, so I'll probably be using it for a while--especially to contact friends who are great distances away.
...
|
| |
|
| Searching Made Interesting |
| 2008-01-06 13:35:00 |
Don't know if you've ever checked out Gizoogle, which is a client that translates web pages for you. It's fun at first, but then it gets kind of old.Recently, I've been playing around with two other clients:Google H4x0r which is their service in leet speak, andElgoog which is Google spelled backwards (pretty self explanatory).These search engines add a unique spin to the otherwise robotic functions they serve on a daily basis.Somewhat related to these alternate means of searching for queries, is Googlism which shows you to see what Google "thinks of you, your friends or anything!" You simply type in someone, somewhere, time, place, etc. and Googlism tells you what it knows about that query.In terms of the Bay Area, Googlism reveals (amongst a host of results):bay area is stunning during ...
|
| |
|
| Bored? Check Out These Psychological Studies and Tests |
| 2008-01-04 23:51:00 |
Having taken Political Psychology, I've developed a new fondness for psychology and how it impacts our lives. Particularly, this is with regards to matters that are fairly intrinsic to how we operate.Here is a collection of surveys, test, and articles that I've found particularly interesting about this topic :)Tests and SurveysHave you checked out what your Personal DNA is? I'm an Advocating Director which does actually seem pretty accurate. What are you? NOTE: This test takes a little while, but the results are really intriguing (including ways to change any given facet of your personality as you see fit).Academic ones care of the BBC:Memory trainingTry to improve your recall using World memory champion Andi Bell's technique.Explore your memoryStretch ...
|
| |
|
| Making Money Through Surveys? |
| 2008-01-04 13:44:00 |
There are a lot of interesting offers out there promising this and that, and although they may look great in the beginning, things may not continue to pan out that way after subscribing.Despite the fact that I had not had any real problems with one called InboxDollars, I still couldn't help but think, what do they have going on? This was because, despite the fact that you get a certain number of cents for each email read, the minimum to cash out is exorbitantly high. Check out this math:You get $5.00 upfront and lets say $.02 for each email.Furthermore, you need $30.00 to cash out.That means, if you don't do any of the deals listed on their site (which in some cases are sketchy, involving credit cards and whatnot) you must read...30=5+.02x25=.02xx=1250 emails1250 EMAILS?Think of all the cookies they must install on your computer, and how much advertising revenue this must all accumulate to.Luckily, I only did this for a little bit before checking. Consequently, I have canceled my account.So yes, this is just a warning about signing up for this and that. On the outskirts of this page are sites that I am registered for and have seen returns from. Also posted are relevant ads from google about content on the page :)
...
|
| |
|
| |
 |
|
| |
| |
|
 |